PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g18890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 319aa    MW: 35956.1 Da    PI: 7.307
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g18890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092472812155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  Vang11g18890.1 247 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 281
                     569*****************************885 PP

2ELK38.42.6e-13201221121
             ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                     ELK qLlrKY+gyLgsLkqEF
  Vang11g18890.1 201 ELKGQLLRKYRGYLGSLKQEF 221
                     9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-20105149IPR005540KNOX1
PfamPF037908.2E-23106146IPR005540KNOX1
PfamPF037894.8E-9201221IPR005539ELK domain
SMARTSM011885.9E-7201222IPR005539ELK domain
PROSITE profilePS5121311.139201221IPR005539ELK domain
PROSITE profilePS5007113.07221284IPR001356Homeobox domain
SuperFamilySSF466891.45E-19223298IPR009057Homeodomain-like
SMARTSM003897.4E-13223288IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-28226286IPR009057Homeodomain-like
CDDcd000861.10E-12233285No hitNo description
PfamPF059205.4E-17241280IPR008422Homeobox KN domain
PROSITE patternPS000270259282IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGFGENTSSS GVCPMMMMPL VTSHHGGHHP LNPNLNNPNR NLNENTNTNT LFIPMPSTNN  60
NHHPNRNSIH DINHNTNTSE LGYFMEIHNR NTNNNNDGSS SSSSSAVKAK IMAHPHYHRL  120
LAAYVNCQKV GAPPEVVARL EEACASSAVT MAGGTARIGE DPALDQFMEA YSCNEGGDRN  180
GSSEEIDVQN NIIDPQAEDQ ELKGQLLRKY RGYLGSLKQE FTKKRKKGKL PKEARQQLLD  240
WWSRHYKWPY PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVVDPNHPHY  300
YMENVLANPF PDLSHTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216225LKQEFTKKRK
2222226KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509083.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-131HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0S3R9P20.0A0A0S3R9P2_PHAAN; Uncharacterized protein
STRINGGLYMA07G39350.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-101KNOX/ELK homeobox transcription factor